General Information

  • ID:  hor004571
  • Uniprot ID:  P62328
  • Protein name:  Thymosin beta-4
  • Gene name:  TMSB4X
  • Organism:  Homo sapiens (Human)
  • Family:  Thymosin beta family
  • Source:  Human
  • Expression:  By alpha interferons. Decreased levels in THP-1 cells after treatment with recombinant interferon-lambda. |Expressed in several hemopoietic cell lines and lymphoid malignant cells. Decreased levels in myeloma cells.
  • Disease:  Diseases associated with TMSB4X include Osteoarthritis and Pulmonary Systemic Sclerosis.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003723 RNA binding; GO:0003779 actin binding; GO:0003785 actin monomer binding; GO:0005515 protein binding; GO:0019899 enzyme binding; GO:0140311 protein sequestering activity
  • GO BP:  GO:0007015 actin filament organization; GO:0030334 regulation of cell migration; GO:0033209 tumor necrosis factor-mediated signaling pathway; GO:0042989 sequestering of actin monomers; GO:0043124 negative regulation of canonical NF-kappaB signal transduction; GO:0043536 positive regulation of blood vessel endothelial cell migration; GO:0050728 negative regulation of inflammatory response; GO:1905273 positive regulation of proton-transporting ATP synthase activity, rotational mechanism; GO:2001028 positive regulation of endothelial cell chemotaxis; GO:2001171 positive regulation of ATP biosynthetic process
  • GO CC:  GO:0005576 extracellular region; GO:0005634 nucleus; GO:0005737 cytoplasm; GO:0005829 cytosol; GO:0005856 cytoskeleton; GO:0031093 platelet alpha granule lumen

Sequence Information

  • Sequence:  SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Length:  43
  • Propeptide:  MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Signal peptide:  NA
  • Modification:  T1 N-acetylserine;T1 Phosphoserine;T3 N6-acetyllysine;T11 N6-acetyllysine;T22 Phosphothreonine;T25 N6-acetyllysine;T30 Phosphoserine;T31 N6-acetyllysine;T33 Phosphothreonine;T38 N6-acetyllysine
  • Glycosylation:  NA
  • Mutagenesis:  11-11K->P: Very weak actin binding; 15-15K->P: Very weak actin binding; 15-15K->P: Very weak actin binding; 17-17K->P: Very weak actin binding

Activity

  • Function:  Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P62328-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004571_AF2.pdbhor004571_ESM.pdb

Physical Information

Mass: 567077 Formula: C210H348N56O77S
Absent amino acids: CHRVWY Common amino acids: K
pI: 4.72 Basic residues: 9
Polar residues: 9 Hydrophobic residues: 7
Hydrophobicity: -170.23 Boman Index: -14559
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 40.93
Instability Index: 6170.23 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  25946035
  • Title:  Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.